PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J272800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 427aa    MW: 45849.6 Da    PI: 4.3581
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J272800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF435.9e-141250341
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                       i  ks rq +f kRr +++ KA  LS+LC++ +avi+++
  Pavir.J272800.1.p 12 IVQKSERQASFRKRRSTLFDKARDLSILCQVPAAVIVYG 50
                       56799*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.675250IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-14261IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-5424IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-17590IPR002100Transcription factor, MADS-box
CDDcd002662.57E-18686No hitNo description
PfamPF003191.7E-121450IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-52439IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MPRSGKVKIQ WIVQKSERQA SFRKRRSTLF DKARDLSILC QVPAAVIVYG GGEAEPQVWP  60
GVQEVTEILR RYRDLPDSLK EARSLDNERI MRRRTEKMRR KLDNCRASAS RLEVNLILND  120
ISLGRSSDFA DLPRELAGAV ASTLDALRSV TADRVNFLRS EAAKAAALPQ QELEEAVAAA  180
LMALQEPPMV PPVAMAPPMV ANAPLVQPAP PQSALVVPPP PQQLQPMVPP LAMAPLVAGA  240
PLLLPAPEPE PEPPVVPPLA MAPVLDDSPL DLLLLLLPDP EPVPPQSELM VAPAPALQEP  300
PMVADMPLLL PAPLPEPPMM PPLYMAPVLD DASLDLLLLL LPDPEPVPPQ SELVVAAAPP  360
LQEPPIMVAD APLLLPAVEP EPPAAAAGAV VDEPLNLYAE PRDGSFLLEM ADAIMHGRRQ  420
WSPGHS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3ZDZ11e-132K3ZDZ1_SETIT; Uncharacterized protein
STRINGSi024783m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2104367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.11e-13AGAMOUS-like 46